Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-4 (TVBL4)

This Recombinant Human T cell receptor beta variable 12-4 (TVBL4) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-4 TRBV12-4

UniProt

A0A0B4J2E0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIQSPRHEVTEMGQEVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(Diisopropylamino)ethanol
TRC-D968000-250MG 250 mg

2-(Diisopropylamino)ethanol

Sign In for Pricing
View Details
TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI1E3]
CF814546 100 µg

TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI1E3]

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF405S conjugate, 0.1mg/mL
BNC041841-100 1x 100 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSA (Prostate Specific Antigen) (A67-B/E3), CF568 conjugate, 0.1mg/mL
BNC680883-100 1x 100 µL

PSA (Prostate Specific Antigen) (A67-B/E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RSPH10B2 Human Gene Knockout Kit (CRISPR)
KN421344 1 Kit

RSPH10B2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (3F1), CF405S conjugate, 0.1mg/mL
BNC042029-500 1x 500 µL

ARF1 (Golgi Apparatus Marker) (3F1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details