Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-4 (TVBL4)

This Recombinant Human T cell receptor beta variable 12-4 (TVBL4) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-4 TRBV12-4

UniProt

A0A0B4J2E0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIQSPRHEVTEMGQEVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Mouse CD4 Antibody[RM4-5]
FCE3803-01 50 Tests

PE/Cyanine7 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD4 Antibody[RM4-5]
FCE3803-02 100 Tests

PE/Cyanine7 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD4 Antibody[RM4-5]
FCE3803-03 2x 100 Tests

PE/Cyanine7 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
Human Calcium-activated chloride channel regulator 4, CLCA4 ELISA Kit
MBS1607329-01 48 Well

Human Calcium-activated chloride channel regulator 4, CLCA4 ELISA Kit

Sign In for Pricing
View Details
Human Calcium-activated chloride channel regulator 4, CLCA4 ELISA Kit
MBS1607329-02 96 Well

Human Calcium-activated chloride channel regulator 4, CLCA4 ELISA Kit

Sign In for Pricing
View Details
Human Calcium-activated chloride channel regulator 4, CLCA4 ELISA Kit
MBS1607329-03 5x 96 Well

Human Calcium-activated chloride channel regulator 4, CLCA4 ELISA Kit

Sign In for Pricing
View Details