Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D)

This Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69D IGHV1-69D

UniProt

A0A0B4J2H0

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLE2 3'UTR Lenti-reporter-Luc Vector
46757081 1.0 µg

TLE2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human CAMKK2 (NM_001270485) AAV Particle
RC234502A1V 250 µL

Human CAMKK2 (NM_001270485) AAV Particle

Sign In for Pricing
View Details
SEMA4A, NT (SEMA4A, SEMAB, SEMB, Semaphorin-4A, Semaphorin-B) (Biotin)
MBS6346000-01 0.2 mL

SEMA4A, NT (SEMA4A, SEMAB, SEMB, Semaphorin-4A, Semaphorin-B) (Biotin)

Sign In for Pricing
View Details
SEMA4A, NT (SEMA4A, SEMAB, SEMB, Semaphorin-4A, Semaphorin-B) (Biotin)
MBS6346000-02 5x 0.2 mL

SEMA4A, NT (SEMA4A, SEMAB, SEMB, Semaphorin-4A, Semaphorin-B) (Biotin)

Sign In for Pricing
View Details
Hck sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6875906 1.0 µg DNA

Hck sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Rabbit Monoclonal Human Respiratory Syncytial Virus A2 Fusion Protein Antibody (R338) [Janelia Fluor 669]
NBP2-89761JF669 0.2 mL

Rabbit Monoclonal Human Respiratory Syncytial Virus A2 Fusion Protein Antibody (R338) [Janelia Fluor 669]

Sign In for Pricing
View Details