Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6-21 (KV621)

This Recombinant Human Immunoglobulin kappa variable 6-21 (KV621) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6-21 IGKV6-21

UniProt

A0A0C4DH24

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSFSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SENP1 Antibody
MBS7117012-01 0.05 mg

SENP1 Antibody

Sign In for Pricing
View Details
SENP1 Antibody
MBS7117012-02 0.1 mg

SENP1 Antibody

Sign In for Pricing
View Details
SENP1 Antibody
MBS7117012-03 5x 0.1 mg

SENP1 Antibody

Sign In for Pricing
View Details
PKD1/2/3 Antibody
E19-8868-2 100 µg -100 µL

PKD1/2/3 Antibody

Sign In for Pricing
View Details
BC062588 Protein Vector (Human) (pPB-N-His)
PV003794 500 ng

BC062588 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
2-Bromo-5-fluoro-4-nitropyridine 1-oxide
FB86005-01 5 g

2-Bromo-5-fluoro-4-nitropyridine 1-oxide

Sign In for Pricing
View Details