Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6-21 (KV621)

This Recombinant Human Immunoglobulin kappa variable 6-21 (KV621) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6-21 IGKV6-21

UniProt

A0A0C4DH24

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSFSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FEM1C Protein Lysate
OCOA09224-20UG 20 µg

FEM1C Protein Lysate

Sign In for Pricing
View Details
Olfr1512 Lentiviral Activation Particles (m)
sc-434573-LAC 200 µL

Olfr1512 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Mouse Ubiquitin-like protein 4A, UBL4A ELISA Kit
MBS9335351-01 48 Well

Mouse Ubiquitin-like protein 4A, UBL4A ELISA Kit

Sign In for Pricing
View Details
Mouse Ubiquitin-like protein 4A, UBL4A ELISA Kit
MBS9335351-02 96 Well

Mouse Ubiquitin-like protein 4A, UBL4A ELISA Kit

Sign In for Pricing
View Details
Mouse Ubiquitin-like protein 4A, UBL4A ELISA Kit
MBS9335351-03 5x 96 Well

Mouse Ubiquitin-like protein 4A, UBL4A ELISA Kit

Sign In for Pricing
View Details
Mouse Ubiquitin-like protein 4A, UBL4A ELISA Kit
MBS9335351-04 10x 96 Well

Mouse Ubiquitin-like protein 4A, UBL4A ELISA Kit

Sign In for Pricing
View Details