Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6-21 (KV621)

This Recombinant Human Immunoglobulin kappa variable 6-21 (KV621) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6-21 IGKV6-21

UniProt

A0A0C4DH24

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSFSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ahsa2 3'UTR Lenti-reporter-Luc Vector
11564084 1.0 µg

Ahsa2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
H3N2 Influenza A- Virus Switzerland 2013 Recombinant
rAP-5424 1 Each

H3N2 Influenza A- Virus Switzerland 2013 Recombinant

Sign In for Pricing
View Details
Cranberry Extract
E3469-5mg 5 mg

Cranberry Extract

Sign In for Pricing
View Details
FAM90A8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0735307 1.0 µg DNA

FAM90A8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
UBE1C (UBA3) Mouse Monoclonal Antibody [Clone ID: LBI7H6]
AMM20524VCF 100 µg

UBE1C (UBA3) Mouse Monoclonal Antibody [Clone ID: LBI7H6]

Sign In for Pricing
View Details
PCNA (human), functional, WB, Dot, SDS-PAGE, ELISA
10-152 Inquire

PCNA (human), functional, WB, Dot, SDS-PAGE, ELISA

Sign In for Pricing
View Details