Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-20 (KVD20)

This Recombinant Human Immunoglobulin kappa variable 3D-20 (KVD20) spans the amino acid sequence from region 21-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-20 IGKV3D-20

UniProt

A0A0C4DH25

Expression Region

21-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCGASQSVSSSYLAWYQQKPGLAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PLA2G16/HRASLS3 Antibody (OTI1A5) [HRP]
NBP2-73454H 0.1 mL

Mouse Monoclonal PLA2G16/HRASLS3 Antibody (OTI1A5) [HRP]

Sign In for Pricing
View Details
GATSL2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
21340061 1.0 µg DNA

GATSL2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
5-Propargylamino-dCTP - Solution
NU-809L 5x 10 μL

5-Propargylamino-dCTP - Solution

Sign In for Pricing
View Details
2-[4- (2-Fluorophenyl) -tetrahydro-2H-pyran-4-yl]acetic acid
PC403164 1 Each

2-[4- (2-Fluorophenyl) -tetrahydro-2H-pyran-4-yl]acetic acid

Sign In for Pricing
View Details
Coatomer Protein complex, subunit epsilon
311440 100 µL

Coatomer Protein complex, subunit epsilon

Sign In for Pricing
View Details
Anti-LGALS3/Galectin-3 Antibody (R1Q62)
RHD27104 100 μg

Anti-LGALS3/Galectin-3 Antibody (R1Q62)

Sign In for Pricing
View Details