Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-20 (KVD20)

This Recombinant Human Immunoglobulin kappa variable 3D-20 (KVD20) spans the amino acid sequence from region 21-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-20 IGKV3D-20

UniProt

A0A0C4DH25

Expression Region

21-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCGASQSVSSSYLAWYQQKPGLAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Yersinia Enterocolitica YE1335 Protein (aa 1-151) (strain 8081)
VAng-Wyb1947-inquire Inquire

Recombinant Yersinia Enterocolitica YE1335 Protein (aa 1-151) (strain 8081)

Sign In for Pricing
View Details
LACTB Rabbit pAb
E45R30097N-50 50 µL

LACTB Rabbit pAb

Sign In for Pricing
View Details
Anti-eIF2B3 Rabbit pAb
GB114048 100 μL

Anti-eIF2B3 Rabbit pAb

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) YCIZ Polyclonal Antibody
MBS7185863 Inquire

Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) YCIZ Polyclonal Antibody

Sign In for Pricing
View Details
FABP12 Rabbit Polyclonal Antibody
orb1544166-01 50 μL

FABP12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FABP12 Rabbit Polyclonal Antibody
orb1544166-02 100 µL

FABP12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details