Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 6D-41 (KVD41)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 6D-41 (KVD41) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 6D-41 IGKV6D-41

UniProt

A0A0C4DH26

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVVMTQSPAFLSVTPGEKVTITCQASEGIGNYLYWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTFTISSLEAEDAATYYCQQGNKHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX10 Antibody, HRP conjugated
A35426-100UL 100 µL

SOX10 Antibody, HRP conjugated

Sign In for Pricing
View Details
2-Amino-3-chloro-anthraquinone
sc-274184 1 g

2-Amino-3-chloro-anthraquinone

Sign In for Pricing
View Details
Ceacam9 AAV siRNA Pooled Vector
15820166 1.0 µg

Ceacam9 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
STAU2 Polyclonal Antibody, APC-Cy7 Conjugated
bs-11031R-APC-Cy7 100 µL

STAU2 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Buspirone-d8 Hydrochloride (8-[4-[4- (2-Pyrimidinyl) -1-piperazinyl]butyl-d8]-8-azaspiro[4.5]decane-7,9-dione, Ansial-d8, Ansiced-d8, Axoren-d8, Bespar-d8, Buspar-d8, Narol-d8)
B8996 1 mg

Buspirone-d8 Hydrochloride (8-[4-[4- (2-Pyrimidinyl) -1-piperazinyl]butyl-d8]-8-azaspiro[4.5]decane-7,9-dione, Ansial-d8, Ansiced-d8, Axoren-d8, Bespar-d8, Buspar-d8, Narol-d8)

Sign In for Pricing
View Details
Olr943 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7142104 1.0 µg DNA

Olr943 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details