Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 6D-41 (KVD41)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 6D-41 (KVD41) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 6D-41 IGKV6D-41

UniProt

A0A0C4DH26

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVVMTQSPAFLSVTPGEKVTITCQASEGIGNYLYWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTFTISSLEAEDAATYYCQQGNKHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RYK Protein, N-His
AP91468 50 µg

Recombinant Human RYK Protein, N-His

Sign In for Pricing
View Details
UTP14A (NM_006649) Human Tagged ORF Clone Lentiviral Particle
RC201719L4V 200 µL

UTP14A (NM_006649) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-PARN Antibody Picoband® (APC Conjugate)
A01501-2-APC 100 µg/Vial

Anti-PARN Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details
TAS2R9 Human shRNA Plasmid Kit (Locus ID 50835)
TR301218 1 Kit

TAS2R9 Human shRNA Plasmid Kit (Locus ID 50835)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized protein Rv0497/MT0517 (Rv0497, MT0517), partial
MBS7061995 Inquire

Recombinant Mycobacterium tuberculosis Uncharacterized protein Rv0497/MT0517 (Rv0497, MT0517), partial

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) TIP5-1 Polyclonal Antibody
MBS9009760 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) TIP5-1 Polyclonal Antibody

Sign In for Pricing
View Details