Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 4 (TRGV4)

This Recombinant Human T cell receptor gamma variable 4 (TRGV4) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 4 TRGV4 TCRGV4

UniProt

A0A0C4DH28

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISPGKYDTYGSTRKNLRMILRNLIENDSGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Stomach
CP565609 150 µg

Tissue Protein Lysate, Stomach

Sign In for Pricing
View Details
CD45 / LCA Rat Monoclonal Antibody [Clone ID: EM-05]
AM26024AC-N 100 µg

CD45 / LCA Rat Monoclonal Antibody [Clone ID: EM-05]

Sign In for Pricing
View Details
NF2 Antibody
KC-15847-01 50 μL

NF2 Antibody

Sign In for Pricing
View Details
NF2 Antibody
KC-15847-02 100 µL

NF2 Antibody

Sign In for Pricing
View Details
NF2 Antibody
KC-15847-03 1 mL

NF2 Antibody

Sign In for Pricing
View Details
N-Ethyldeoxynojirimycin Hydrochloride
TRC-E915000-5MG 5 mg

N-Ethyldeoxynojirimycin Hydrochloride

Sign In for Pricing
View Details