Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 4 (TRGV4)

This Recombinant Human T cell receptor gamma variable 4 (TRGV4) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 4 TRGV4 TCRGV4

UniProt

A0A0C4DH28

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISPGKYDTYGSTRKNLRMILRNLIENDSGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TRMT9B activation kit by CRISPRa
GA111626 1 Kit

Human TRMT9B activation kit by CRISPRa

Sign In for Pricing
View Details
ReadiCleave™ Cy5-SSL-NHS ester
7050-AAT 1 mg

ReadiCleave™ Cy5-SSL-NHS ester

Sign In for Pricing
View Details
Iodoethane-1,1-d2 (Stabilized with Copper)
TRC-I705874-500MG 500 mg

Iodoethane-1,1-d2 (Stabilized with Copper)

Sign In for Pricing
View Details
TIMELESS Rabbit Monoclonal Antibody [Clone ID: R01-7H7]
TA422153 100 µL

TIMELESS Rabbit Monoclonal Antibody [Clone ID: R01-7H7]

Sign In for Pricing
View Details
Mouse Galnt3 activation kit by CRISPRa
GA201536 1 Kit

Mouse Galnt3 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human XRP2/RP2 Protein (GST Tag)
PKSH031261 100 µg

Recombinant Human XRP2/RP2 Protein (GST Tag)

Sign In for Pricing
View Details