Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-3 (HV103)

This Recombinant Human Immunoglobulin heavy variable 1-3 (HV103) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-3 IGHV1-3

UniProt

A0A0C4DH29

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQAPGQRLEWMGWINAGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PPAR gamma Rabbit Monoclonal Antibody
MA4692-.1 100 µL

Anti-PPAR gamma Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
IL-1 beta
103-M535 50 µg

IL-1 beta

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) GR58C Polyclonal Antibody
MBS9014270 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) GR58C Polyclonal Antibody

Sign In for Pricing
View Details
Hsa-miR-96-5p mimic
HY-R02538-01 5 nmol

Hsa-miR-96-5p mimic

Sign In for Pricing
View Details
Hsa-miR-96-5p mimic
HY-R02538-02 20 nmol

Hsa-miR-96-5p mimic

Sign In for Pricing
View Details
PE-Labeled Human IL-15 R alpha / CD215 Protein, Fc Tag (Site-specific conjugation)
ILA-HP2F6-25tests 25 Tests

PE-Labeled Human IL-15 R alpha / CD215 Protein, Fc Tag (Site-specific conjugation)

Sign In for Pricing
View Details