Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-24 (HV124)

This Recombinant Human Immunoglobulin heavy variable 1-24 (HV124) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-24 IGHV1-24

UniProt

A0A0C4DH33

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRH Recombinant Protein
OPCD02410-10UG 10 µg

CRH Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal FAM134A Antibody
NBP1-91168 0.1 mL

Rabbit Polyclonal FAM134A Antibody

Sign In for Pricing
View Details
SEC14L3 shRNA Plasmid (h)
sc-106537-SH 20 µg

SEC14L3 shRNA Plasmid (h)

Sign In for Pricing
View Details
Butyl Triacontanoate
TRC-B750100-10MG 10 mg

Butyl Triacontanoate

Sign In for Pricing
View Details
Bcl-X (S56) polyclonal antibody
orb642542-01 25 µL

Bcl-X (S56) polyclonal antibody

Sign In for Pricing
View Details
Bcl-X (S56) polyclonal antibody
orb642542-02 50 μL

Bcl-X (S56) polyclonal antibody

Sign In for Pricing
View Details