Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-28 (HV428)

This Recombinant Human Immunoglobulin heavy variable 4-28 (HV428) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-28 IGHV4-28

UniProt

A0A0C4DH34

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSDTLSLTCAVSGYSISSSNWWGWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAVDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oct4 Rabbit Polyclonal Antibody
R1107-3 100 µL

Oct4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD8 Antibody[UCHT-4]
AN00427G-01 20 Tests

PE/Cyanine5 Anti-Human CD8 Antibody[UCHT-4]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD8 Antibody[UCHT-4]
AN00427G-02 100 Tests

PE/Cyanine5 Anti-Human CD8 Antibody[UCHT-4]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD8 Antibody[UCHT-4]
AN00427G-03 2x 100 Tests

PE/Cyanine5 Anti-Human CD8 Antibody[UCHT-4]

Sign In for Pricing
View Details
SCARB1 (NM_005505) Human Over-expression Lysate
LY401684 100 µg

SCARB1 (NM_005505) Human Over-expression Lysate

Sign In for Pricing
View Details
GTF2A2 Polyclonal Antibody
E-AB-18882-01 20 µL

GTF2A2 Polyclonal Antibody

Sign In for Pricing
View Details