Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-28 (HV428)

This Recombinant Human Immunoglobulin heavy variable 4-28 (HV428) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-28 IGHV4-28

UniProt

A0A0C4DH34

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSDTLSLTCAVSGYSISSSNWWGWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAVDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orbital Shaker BSOT-1604
BSOT-1604 1 Unit

Orbital Shaker BSOT-1604

Sign In for Pricing
View Details
PPP1R14A (Isoform alpha) Rabbit Polyclonal Antibody
AP09505PU-N 100 µL

PPP1R14A (Isoform alpha) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AGXT (NM_000030) Human Recombinant Protein
TP312899 20 µg

AGXT (NM_000030) Human Recombinant Protein

Sign In for Pricing
View Details
CD38 Antibody
KC-862-01 50 μL

CD38 Antibody

Sign In for Pricing
View Details
CD38 Antibody
KC-862-02 100 µL

CD38 Antibody

Sign In for Pricing
View Details
CD38 Antibody
KC-862-03 1 mL

CD38 Antibody

Sign In for Pricing
View Details