Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-28 (HV428)

This Recombinant Human Immunoglobulin heavy variable 4-28 (HV428) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-28 IGHV4-28

UniProt

A0A0C4DH34

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSDTLSLTCAVSGYSISSSNWWGWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAVDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRAMEF9 sgRNA CRISPR Lentivector set (Human)
K1713001 3x 1.0 µg

PRAMEF9 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Anti Human HCRT Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (IHC,ELISA) 200UL
IRBAMLHCRTAAP17200UL 200 µL

Rabbit Anti Human HCRT Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (IHC,ELISA) 200UL

Sign In for Pricing
View Details
CDH3/Cadherin 3 Protein, Mouse, Recombinant (C-His)
E51P00635 100 µg

CDH3/Cadherin 3 Protein, Mouse, Recombinant (C-His)

Sign In for Pricing
View Details
MMP-9 Antibody
C30044-01 50 µL

MMP-9 Antibody

Sign In for Pricing
View Details
MMP-9 Antibody
C30044-02 100 µL

MMP-9 Antibody

Sign In for Pricing
View Details
CBX3 Protein Lysate (Human) with C-Ha Tag
15134031 100 µg

CBX3 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details