Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338) spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38 IGHV3-38

UniProt

A0A0C4DH36

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPRGSLRLSCAASGFTVSSNEMSWIRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLYLQMNNLRAEGTAVYYCARY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF385C activation kit by CRISPRa
GA116381 1 Kit

Human ZNF385C activation kit by CRISPRa

Sign In for Pricing
View Details
KIF3B (NM_004798) Human Recombinant Protein
TP313911 20 µg

KIF3B (NM_004798) Human Recombinant Protein

Sign In for Pricing
View Details
MRPS36 Antibody
8C16663-AAT 50 µg

MRPS36 Antibody

Sign In for Pricing
View Details
ErbB 3 (ERBB3) (NM_001005915) Human Over-expression Lysate
LY425161 100 µg

ErbB 3 (ERBB3) (NM_001005915) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MHCG (Major Histocompatibility Complex Class I G) CLIA Kit
E-CL-H1055-01 24 Tests

Human MHCG (Major Histocompatibility Complex Class I G) CLIA Kit

Sign In for Pricing
View Details
Human MHCG (Major Histocompatibility Complex Class I G) CLIA Kit
E-CL-H1055-02 48 Tests

Human MHCG (Major Histocompatibility Complex Class I G) CLIA Kit

Sign In for Pricing
View Details