Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338) spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38 IGHV3-38

UniProt

A0A0C4DH36

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPRGSLRLSCAASGFTVSSNEMSWIRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLYLQMNNLRAEGTAVYYCARY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTPBP3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
22820066 1.0 µg DNA

GTPBP3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MIOS shRNA (m) Lentiviral Particles
sc-141518-V 200 µL

MIOS shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
TPRG1L Rabbit pAb
E45R22540N-100 100 µL

TPRG1L Rabbit pAb

Sign In for Pricing
View Details
Mal-amido-peg6-NHS
TRC-M111053-50MG 50 mg

Mal-amido-peg6-NHS

Sign In for Pricing
View Details
PNMT Protein Vector (Mouse) (pPM-C-HA)
37109024 500 ng

PNMT Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human Leukocyte Elastase Inhibitor (LEI) ELISA Kit
RD-LEI-Hu-96Tests 96 Tests

Human Leukocyte Elastase Inhibitor (LEI) ELISA Kit

Sign In for Pricing
View Details