Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-51 (HV551)

This Recombinant Human Immunoglobulin heavy variable 5-51 (HV551) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-51 IGHV5-51

UniProt

A0A0C4DH38

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Her2 His Tag Protein, Cynomolgus
UA010241-01 25 µg

Her2 His Tag Protein, Cynomolgus

Sign In for Pricing
View Details
Her2 His Tag Protein, Cynomolgus
UA010241-02 100 µg

Her2 His Tag Protein, Cynomolgus

Sign In for Pricing
View Details
Her2 His Tag Protein, Cynomolgus
UA010241-03 500 µg

Her2 His Tag Protein, Cynomolgus

Sign In for Pricing
View Details
LHX6 Polyclonal Antibody, FITC Conjugated
bs-7869R-FITC 100 µL

LHX6 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
IL-1R1 Rabbit Polyclonal Antibody (Cy5)
orb905916 100 µL

IL-1R1 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Olr1060 CRISPRa sgRNA lentivector (set of three targets)(Rat)
33639126 3x 1.0µg DNA

Olr1060 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details