Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-51 (HV551)

This Recombinant Human Immunoglobulin heavy variable 5-51 (HV551) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-51 IGHV5-51

UniProt

A0A0C4DH38

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HES6 Mouse Monoclonal Antibody [Clone ID: LBI1H2]
AMM14778V 100 µL

HES6 Mouse Monoclonal Antibody [Clone ID: LBI1H2]

Sign In for Pricing
View Details
p38-alpha MAPK-IN-4
MBS5803801 Inquire

p38-alpha MAPK-IN-4

Sign In for Pricing
View Details
Cte Probe
FBPC-251 50 to 100 Tests

Cte Probe

Sign In for Pricing
View Details
Lipophilin B Rabbit Polyclonal Antibody (BF750)
orb2399917 100 µL

Lipophilin B Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
pCMV-SPORT6-MTBP Plasmid
PVT14368 2 µg

pCMV-SPORT6-MTBP Plasmid

Sign In for Pricing
View Details
Plant GDP Dissociation Inhibitor 1 (GDI1) ELISA Kit
MBS9380917 Inquire

Plant GDP Dissociation Inhibitor 1 (GDI1) ELISA Kit

Sign In for Pricing
View Details