Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-51 (HV551)

This Recombinant Human Immunoglobulin heavy variable 5-51 (HV551) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-51 IGHV5-51

UniProt

A0A0C4DH38

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp1r14b (NM_172045) Rat Tagged ORF Clone Lentiviral Particle
RR207956L3V 200 µL

Ppp1r14b (NM_172045) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Hs6st1 Stable Knockout Heparan Sulfate Cell Line (Hs6st1-/-)
T3380 1x106 cells / 1.0 mL

Hs6st1 Stable Knockout Heparan Sulfate Cell Line (Hs6st1-/-)

Sign In for Pricing
View Details
ATF5 Recombinant Antibody
bsm-61324R-01 20 µL

ATF5 Recombinant Antibody

Sign In for Pricing
View Details
ATF5 Recombinant Antibody
bsm-61324R-02 100 µL

ATF5 Recombinant Antibody

Sign In for Pricing
View Details
CPNE8 Antibody : Biotin (OAAF03532-Biotin)
OAAF03532-100UG-Biotin 100 µg

CPNE8 Antibody : Biotin (OAAF03532-Biotin)

Sign In for Pricing
View Details
Smok3b-set siRNA/shRNA/RNAi Lentivector (Mouse)
44464094 4x 500 ng

Smok3b-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details