Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-58 (HV158)

This Recombinant Human Immunoglobulin heavy variable 1-58 (HV158) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-58 IGHV1-58

UniProt

A0A0C4DH39

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QMQLVQSGPEVKKPGTSVKVSCKASGFTFTSSAVQWVRQARGQRLEWIGWIVVGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Defb4/Beta-defensin 4 ELISA Kit
E0290Ra 96 Tests

Rat Defb4/Beta-defensin 4 ELISA Kit

Sign In for Pricing
View Details
Olfr67 Mouse shRNA Plasmid (Locus ID 18368)
TL501553 1 Kit

Olfr67 Mouse shRNA Plasmid (Locus ID 18368)

Sign In for Pricing
View Details
ADGRE1 Peptide - C-terminal region
MBS3241307-01 0.1 mg

ADGRE1 Peptide - C-terminal region

Sign In for Pricing
View Details
ADGRE1 Peptide - C-terminal region
MBS3241307-02 5x 0.1 mg

ADGRE1 Peptide - C-terminal region

Sign In for Pricing
View Details
Anti-Kinesin light chain 1 Antibody (8H725)
TMAS-00361-01 50 μL

Anti-Kinesin light chain 1 Antibody (8H725)

Sign In for Pricing
View Details
Anti-Kinesin light chain 1 Antibody (8H725)
TMAS-00361-02 100 µL

Anti-Kinesin light chain 1 Antibody (8H725)

Sign In for Pricing
View Details