Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-61 (HV461)

This Recombinant Human Immunoglobulin heavy variable 4-61 (HV461) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-61 IGHV4-61

UniProt

A0A0C4DH41

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RhoC Antibody
NBP3-03322-20ul 20 µL

Rabbit Polyclonal RhoC Antibody

Sign In for Pricing
View Details
Human muscarinic acetylcholine receptor M2, M-AChR M2 ELISA Kit
CK-bio-12534-01 48 Tests

Human muscarinic acetylcholine receptor M2, M-AChR M2 ELISA Kit

Sign In for Pricing
View Details
Human muscarinic acetylcholine receptor M2, M-AChR M2 ELISA Kit
CK-bio-12534-02 96 Tests

Human muscarinic acetylcholine receptor M2, M-AChR M2 ELISA Kit

Sign In for Pricing
View Details
Human muscarinic acetylcholine receptor M2, M-AChR M2 ELISA Kit
CK-bio-12534-03 5x 96 Tests

Human muscarinic acetylcholine receptor M2, M-AChR M2 ELISA Kit

Sign In for Pricing
View Details
Human muscarinic acetylcholine receptor M2, M-AChR M2 ELISA Kit
CK-bio-12534-04 10x 96 Tests

Human muscarinic acetylcholine receptor M2, M-AChR M2 ELISA Kit

Sign In for Pricing
View Details
TRNAS32P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV754073 1.0 µg DNA

TRNAS32P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details