Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-61 (HV461)

This Recombinant Human Immunoglobulin heavy variable 4-61 (HV461) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-61 IGHV4-61

UniProt

A0A0C4DH41

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIN3B (NM_015260) Human Over-expression Lysate
LS023309 100 µg

SIN3B (NM_015260) Human Over-expression Lysate

Sign In for Pricing
View Details
KIF5B Recombinant Protein
OPCD04664-50UG 50 µg

KIF5B Recombinant Protein

Sign In for Pricing
View Details
Phospho-Smad2 (S250) Recombinant Rabbit monoclonal Antibody
HA750291 100 µL

Phospho-Smad2 (S250) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
NECAP1 Knockout A549 Polyclonal Cells
ARG10999 1 Million

NECAP1 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
Anti-USP10 antibody
STJ115349 100 µl

Anti-USP10 antibody

Sign In for Pricing
View Details
IL1RAPL2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-11855R-BF555 100 µL

IL1RAPL2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details