Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-61 (HV461)

This Recombinant Human Immunoglobulin heavy variable 4-61 (HV461) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-61 IGHV4-61

UniProt

A0A0C4DH41

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Ornithine Decarboxylase Antibody (rODC1/485) [DyLight 550]
NBP3-08785R 100 µL

Mouse Monoclonal Ornithine Decarboxylase Antibody (rODC1/485) [DyLight 550]

Sign In for Pricing
View Details
Astemizole 100mg
A13899-100 100 mg

Astemizole 100mg

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/826), 0.2mg/mL
BNUB0826-100 1x 100 µL

Ep-CAM / CD326 (EGP40/826), 0.2mg/mL

Sign In for Pricing
View Details
Human TGFB1I1 Matched Antibody Pair Set [IV1164/Poly]
Z01LS-1122-LS348 5 Plates

Human TGFB1I1 Matched Antibody Pair Set [IV1164/Poly]

Sign In for Pricing
View Details
IFluor® 790 Anti-human CD209 Antibody *UW60.1*
120900M0-AAT 100 Tests

IFluor® 790 Anti-human CD209 Antibody *UW60.1*

Sign In for Pricing
View Details
RANK/TNFRSF11A Rabbit Polyclonal Antibody
orb412966 100 µg

RANK/TNFRSF11A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details