Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-66 (HV366)

This Recombinant Human Immunoglobulin heavy variable 3-66 (HV366) spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-66 IGHV3-66

UniProt

A0A0C4DH42

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSCGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNH1 Antibody - middle region
ARP57821_P050-25UL 25 µL

RNH1 Antibody - middle region

Sign In for Pricing
View Details
Mouse Fam210b Pre-designed siRNA Set A
SI104650A 1 Each

Mouse Fam210b Pre-designed siRNA Set A

Sign In for Pricing
View Details
C1qtnf3 3'UTR Luciferase Stable Cell Line
TU201499 1.0 mL

C1qtnf3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CDH11 (Cadherin 11, Type 2, OB-Cadherin (Osteoblast), CAD11, CDHOB, OB, OSF-4) (MaxLight 490)
244486-ML490 100 µL

CDH11 (Cadherin 11, Type 2, OB-Cadherin (Osteoblast), CAD11, CDHOB, OB, OSF-4) (MaxLight 490)

Sign In for Pricing
View Details
OACA12741-50UL
OACA12741-50UL 50 µL

OACA12741-50UL

Sign In for Pricing
View Details
Tnfrsf1a Rat Monoclonal Antibody [Clone ID: HM104]
CL044PS 100 µg

Tnfrsf1a Rat Monoclonal Antibody [Clone ID: HM104]

Sign In for Pricing
View Details