Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-66 (HV366)

This Recombinant Human Immunoglobulin heavy variable 3-66 (HV366) spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-66 IGHV3-66

UniProt

A0A0C4DH42

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSCGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal IKK alpha Antibody [FITC]
NBP2-99049F 0.1 mL

Rabbit Polyclonal IKK alpha Antibody [FITC]

Sign In for Pricing
View Details
Aldolase B (19) : m-IgG2a BP-HRP Bundle
sc-546193 1 Kit

Aldolase B (19) : m-IgG2a BP-HRP Bundle

Sign In for Pricing
View Details
Human Wilms Tumor Protein (WT1) ELISA Kit
RD-WT1-Hu-48Tests 48 Tests

Human Wilms Tumor Protein (WT1) ELISA Kit

Sign In for Pricing
View Details
0610011L14Rik Protein Lysate (Mouse) with C-HA Tag
10014034 100 µg

0610011L14Rik Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Human Trypsin-2 (PRSS2) ELISA Kit
RK06427 96 Tests

Human Trypsin-2 (PRSS2) ELISA Kit

Sign In for Pricing
View Details
Human DNAI1/Dynein Intermediate Chain 1, Axonemal ELISA Kit
MBS2890158 Inquire

Human DNAI1/Dynein Intermediate Chain 1, Axonemal ELISA Kit

Sign In for Pricing
View Details