Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-66 (HV366)

This Recombinant Human Immunoglobulin heavy variable 3-66 (HV366) spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-66 IGHV3-66

UniProt

A0A0C4DH42

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSCGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Liver
CS514968 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
4- (N-Iodoacetamide) benzophenone
TYD-01210-01 100 mg

4- (N-Iodoacetamide) benzophenone

Sign In for Pricing
View Details
4- (N-Iodoacetamide) benzophenone
TYD-01210-02 250 mg

4- (N-Iodoacetamide) benzophenone

Sign In for Pricing
View Details
4- (N-Iodoacetamide) benzophenone
TYD-01210-03 50 mg

4- (N-Iodoacetamide) benzophenone

Sign In for Pricing
View Details
THEM4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2369308 1.0 µg DNA

THEM4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
HE4 Peptide
MBS543660-01 0.25 mg

HE4 Peptide

Sign In for Pricing
View Details