Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D)

This Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-70D IGHV2-70D

UniProt

A0A0C4DH43

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKFYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem14c (NM_025387) Mouse Untagged Clone
MC201641 10 µg

Tmem14c (NM_025387) Mouse Untagged Clone

Sign In for Pricing
View Details
RER1 (HRP)
574585-01 50 µg

RER1 (HRP)

Sign In for Pricing
View Details
RER1 (HRP)
574585-02 100 µg

RER1 (HRP)

Sign In for Pricing
View Details
RN5S110 Adenovirus (Human)
39664051 1.0 mL

RN5S110 Adenovirus (Human)

Sign In for Pricing
View Details
IGFBP1 (14E18) Rabbit Monoclonal Antibody
E28M6242 100 µL

IGFBP1 (14E18) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DiagNano™ ZnSe/ZnS Quantum Dots, 405 nm
DNK-B018 10 mg

DiagNano™ ZnSe/ZnS Quantum Dots, 405 nm

Sign In for Pricing
View Details