Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-4 (TVB54)

This Recombinant Human T cell receptor beta variable 5-4 (TVB54) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-4 TRBV5-4

UniProt

A0A0C4DH59

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSSQSGHNTVSWYQQALGQGPQFIFQYYREEENGRGNFPPRFSGLQFPNYSSELNVNALELDDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUCLA2 Rabbit Polyclonal Antibody
TA370998 100 µL

SUCLA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Monoclonal Anti-Human p-tau181 Antibody, Mouse IgG2a (8D8C10) (MALS verified)
PT1-MY2073-100ug 100 µg

Monoclonal Anti-Human p-tau181 Antibody, Mouse IgG2a (8D8C10) (MALS verified)

Sign In for Pricing
View Details
Kv4.2 / KCND2 Recombinant Mouse monoclonal Antibody
HA610272 100 µg

Kv4.2 / KCND2 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
ZRANB2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E3]
TA809526BM 100 µL

ZRANB2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E3]

Sign In for Pricing
View Details
Sav1 Mouse Gene Knockout Kit (CRISPR)
KN515313 1 Kit

Sav1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IPO11 (C-term) Rabbit Polyclonal Antibody
AP52222PU-N 400 µL

IPO11 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details