Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-24 (KV224)

This Recombinant Human Immunoglobulin kappa variable 2-24 (KV224) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-24 IGKV2-24

UniProt

A0A0C4DH68

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQTPLSSPVTLGQPASISCRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKISNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQATQFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF777 Protein Vector (Human) (pPM-C-HA)
PV145640 500 ng

ZNF777 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
SIN3A Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-61578R-APC-Cy5.5 100 µL

SIN3A Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Quinaldine Red
TRC-Q585003-1G 1 g

Quinaldine Red

Sign In for Pricing
View Details
Twist1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7099108 1.0 µg DNA

Twist1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
PTN13 Polyclonal Antibody
UB-GEN-6813 100 µL

PTN13 Polyclonal Antibody

Sign In for Pricing
View Details
C6orf199 Rabbit Polyclonal Antibody (Biotin)
orb2104996 100 µL

C6orf199 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details