Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-9 (KV109)

This Recombinant Human Immunoglobulin kappa variable 1-9 (KV109) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-9 IGKV1-9

UniProt

A0A0C4DH69

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Creatine-13C3
TRC-C781484-1MG 1 mg

Creatine-13C3

Sign In for Pricing
View Details
DBR1 Human Gene Knockout Kit (CRISPR)
KN200024 1 Kit

DBR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FP-TZTP, >85%
TRC-F756500-5MG 5 mg

FP-TZTP, >85%

Sign In for Pricing
View Details
KLC1 Rabbit Polyclonal Antibody
TA364652 100 µL

KLC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MyGel Mini Electrophoresis System Starter Kit (Includes E1101-E, A1701 and W4000-100)
E1101-SK-E 1 Each

MyGel Mini Electrophoresis System Starter Kit (Includes E1101-E, A1701 and W4000-100)

Sign In for Pricing
View Details
Sell Mouse Gene Knockout Kit (CRISPR)
KN515487 1 Kit

Sell Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details