Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-9 (KV109)

This Recombinant Human Immunoglobulin kappa variable 1-9 (KV109) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-9 IGKV1-9

UniProt

A0A0C4DH69

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Stomach
CS637267 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
3,5-Dibromobenzaldehyde
TRC-D424200-5G 5 g

3,5-Dibromobenzaldehyde

Sign In for Pricing
View Details
LOC138198 Human qPCR Primer Pair (XM_070805)
HP220978 200 Reactions

LOC138198 Human qPCR Primer Pair (XM_070805)

Sign In for Pricing
View Details
Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), 1mg/mL
BNUM1541-50 1x 50 µL

Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), 1mg/mL

Sign In for Pricing
View Details
ZNF605 Human Gene Knockout Kit (CRISPR)
KN422973 1 Kit

ZNF605 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (MUC5AC/917), CF568 conjugate, 0.1mg/mL
BNC680917-500 1x 500 µL

Mucin 5AC (MUC5AC) (MUC5AC/917), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details