Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692)

This Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69-2 IGHV1-69-2

UniProt

A0A0G2JMI3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGATVKISCKVSGYTFTDYYMHWVQQAPGKGLEWMGLVDPEDGETIYAEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lipase, Monoacylglycerol (MGL) ELISA Kit
RDR-MGL-Hu-01 96 Tests

Human Lipase, Monoacylglycerol (MGL) ELISA Kit

Sign In for Pricing
View Details
Human Lipase, Monoacylglycerol (MGL) ELISA Kit
RDR-MGL-Hu-02 48 Tests

Human Lipase, Monoacylglycerol (MGL) ELISA Kit

Sign In for Pricing
View Details
Recombinant N-Cadherin/CD325/CDH2 Monoclonal Antibody
AN300288P-01 20 µL

Recombinant N-Cadherin/CD325/CDH2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant N-Cadherin/CD325/CDH2 Monoclonal Antibody
AN300288P-02 100 µL

Recombinant N-Cadherin/CD325/CDH2 Monoclonal Antibody

Sign In for Pricing
View Details
ZSCAN5B (NM_001080456) Human Over-expression Lysate
LC432267 20 µg

ZSCAN5B (NM_001080456) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PRAMEF2 activation kit by CRISPRa
GA112242 1 Kit

Human PRAMEF2 activation kit by CRISPRa

Sign In for Pricing
View Details