Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692)

This Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69-2 IGHV1-69-2

UniProt

A0A0G2JMI3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGATVKISCKVSGYTFTDYYMHWVQQAPGKGLEWMGLVDPEDGETIYAEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC30B Antibody, FITC conjugated
MBS1499074-01 0.05 mg

TTC30B Antibody, FITC conjugated

Sign In for Pricing
View Details
TTC30B Antibody, FITC conjugated
MBS1499074-02 0.1 mg

TTC30B Antibody, FITC conjugated

Sign In for Pricing
View Details
TTC30B Antibody, FITC conjugated
MBS1499074-03 5x 0.1 mg

TTC30B Antibody, FITC conjugated

Sign In for Pricing
View Details
PAX9 (Paired Box Protein Pax-9) (MaxLight 650)
130913-ML650 100 µL

PAX9 (Paired Box Protein Pax-9) (MaxLight 650)

Sign In for Pricing
View Details
FAM151B Lentiviral Activation Particles (m2)
sc-428672-LAC-2 200 µL

FAM151B Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
S-Deoxo-6-oxo-fulvestrant
HUB60670-01 25 mg

S-Deoxo-6-oxo-fulvestrant

Sign In for Pricing
View Details