Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-39 (LV539)

This Recombinant Human Immunoglobulin lambda variable 5-39 (LV539) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-39 IGLV5-39

UniProt

A0A0G2JS06

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPTSLSASPGASARFTCTLRSGINVGTYRIYWYQQKPGSLPRYLLRYKSDSDKQQGSGVPSRFSGSKDASTNAGLLLISGLQSEDEADYYCAIWYSSTS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atp6v1b2 sgRNA CRISPR Lentivector set (Rat)
K6982201 3x 1.0 µg

Atp6v1b2 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Human CD337/NCR3 Antibody , PE
E55A09981 50 Tests

Human CD337/NCR3 Antibody , PE

Sign In for Pricing
View Details
BAX (Apoptosis Regulator BAX, Bcl-2-like Protein 4, Bcl2-L-4, BCL2L4) (AP)
MBS6130187-01 0.1 mL

BAX (Apoptosis Regulator BAX, Bcl-2-like Protein 4, Bcl2-L-4, BCL2L4) (AP)

Sign In for Pricing
View Details
BAX (Apoptosis Regulator BAX, Bcl-2-like Protein 4, Bcl2-L-4, BCL2L4) (AP)
MBS6130187-02 5x 0.1 mL

BAX (Apoptosis Regulator BAX, Bcl-2-like Protein 4, Bcl2-L-4, BCL2L4) (AP)

Sign In for Pricing
View Details
Paxip1 (NM_018878) Mouse Tagged Lenti ORF Clone
MR211554L3 10 µg

Paxip1 (NM_018878) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Clostridium Perfringens mutS2 Protein (aa 1-786) (strain ATCC 13124 / NCTC 8237 / Type A)
VAng-Lsx00609-inquire Inquire

Recombinant Clostridium Perfringens mutS2 Protein (aa 1-786) (strain ATCC 13124 / NCTC 8237 / Type A)

Sign In for Pricing
View Details