Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741)

This Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 7-4-1 IGHV7-4-1

UniProt

A0A0J9YVY3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGSELKKPGASVKVSCKASGYTFTSYAMNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQICSLKAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDCD1 / PD1 / CD279 (Programmed Cell Death 1), CF594 conjugate, 0.1mg/mL
BNC941457-100 1x 100 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Diphenyl Phosphate
TRC-D492000-5G 5 g

Diphenyl Phosphate

Sign In for Pricing
View Details
ENTPD5 (NM_001249) Human Over-expression Lysate
LC420048 20 µg

ENTPD5 (NM_001249) Human Over-expression Lysate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Human IgA,  5nm
GAF-351-5 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Human IgA, 5nm

Sign In for Pricing
View Details
Rbm12b1 Mouse Gene Knockout Kit (CRISPR)
KN514548 1 Kit

Rbm12b1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Enzalutamide Carboxylic Acid
TRC-E559800-25MG 25 mg

Enzalutamide Carboxylic Acid

Sign In for Pricing
View Details