Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D)

This Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64D IGHV3-64D

UniProt

A0A0J9YX35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCSASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cplx2 activation kit by CRISPRa
GA200856 1 Kit

Mouse Cplx2 activation kit by CRISPRa

Sign In for Pricing
View Details
Prenylamine
TRC-P712800-50MG 50 mg

Prenylamine

Sign In for Pricing
View Details
REXO1L2P Human qPCR Primer Pair (NR_003594)
HP220559 200 Reactions

REXO1L2P Human qPCR Primer Pair (NR_003594)

Sign In for Pricing
View Details
Tissue FFPE Sections, Jejunum
CS800957 5x 5 µm

Tissue FFPE Sections, Jejunum

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/1931), CF640R conjugate, 0.1mg/mL
BNC401931-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/1931), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Oxo-2,3-dihydro-1H-benzo[d]imidazol-5-ylboronic Acid
TRC-O990260-1G 1 g

2-Oxo-2,3-dihydro-1H-benzo[d]imidazol-5-ylboronic Acid

Sign In for Pricing
View Details