Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-10-1 (HV5X1)

This Recombinant Human Immunoglobulin heavy variable 5-10-1 (HV5X1) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-10-1 IGHV5-10-1

UniProt

A0A0J9YXX1

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLRISCKGSGYSFTSYWISWVRQMPGKGLEWMGRIDPSDSYTNYSPSFQGHVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF4 (143-271) Mouse Monoclonal Antibody [Clone ID: ARHGEF-08]
AM26710PU-N 100 µg

ARHGEF4 (143-271) Mouse Monoclonal Antibody [Clone ID: ARHGEF-08]

Sign In for Pricing
View Details
Cooled Incubator BICL-404
BICL-404 1 Unit

Cooled Incubator BICL-404

Sign In for Pricing
View Details
Phorbol
TRC-P353480-5MG 5 mg

Phorbol

Sign In for Pricing
View Details
CIB1 (1-191) Mouse Monoclonal Antibody [Clone ID: 1D1]
AM03117PU-S 50 µL

CIB1 (1-191) Mouse Monoclonal Antibody [Clone ID: 1D1]

Sign In for Pricing
View Details
IL17F Mouse Monoclonal Antibody [Clone ID: B-C52]
AM33382AF-N 500 µg

IL17F Mouse Monoclonal Antibody [Clone ID: B-C52]

Sign In for Pricing
View Details
10b-Hydroxy D-(-)-Norgestrel
TRC-H825710-5MG 5 mg

10b-Hydroxy D-(-)-Norgestrel

Sign In for Pricing
View Details