Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-10-1 (HV5X1)

This Recombinant Human Immunoglobulin heavy variable 5-10-1 (HV5X1) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-10-1 IGHV5-10-1

UniProt

A0A0J9YXX1

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLRISCKGSGYSFTSYWISWVRQMPGKGLEWMGRIDPSDSYTNYSPSFQGHVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldolase (ALDOA) (NM_184041) Human Recombinant Protein
TP303900M 100 µg

Aldolase (ALDOA) (NM_184041) Human Recombinant Protein

Sign In for Pricing
View Details
APC Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09843E-01 25 µg

APC Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
APC Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09843E-02 100 µg

APC Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
RPP25 (NM_017793) Human Recombinant Protein
TP303538M 100 µg

RPP25 (NM_017793) Human Recombinant Protein

Sign In for Pricing
View Details
Tnpo3 Mouse Gene Knockout Kit (CRISPR)
KN518029 1 Kit

Tnpo3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/799 + KRT19/800), CF740 conjugate, 0.1mg/mL
BNC741150-100 1x 100 µL

Cytokeratin 19 (KRT19/799 + KRT19/800), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details