Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-10-1 (HV5X1)

This Recombinant Human Immunoglobulin heavy variable 5-10-1 (HV5X1) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-10-1 IGHV5-10-1

UniProt

A0A0J9YXX1

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLRISCKGSGYSFTSYWISWVRQMPGKGLEWMGRIDPSDSYTNYSPSFQGHVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CDH1 antibody
STJ140027 100 µg

Anti-CDH1 antibody

Sign In for Pricing
View Details
CCNC, NT (CCNC, Cyclin-C, SRB11 homolog) (APC)
MBS6282312-01 0.2 mL

CCNC, NT (CCNC, Cyclin-C, SRB11 homolog) (APC)

Sign In for Pricing
View Details
CCNC, NT (CCNC, Cyclin-C, SRB11 homolog) (APC)
MBS6282312-02 5x 0.2 mL

CCNC, NT (CCNC, Cyclin-C, SRB11 homolog) (APC)

Sign In for Pricing
View Details
Anti-MMUT Antibody (R1R95)
RHD49603 100 μg

Anti-MMUT Antibody (R1R95)

Sign In for Pricing
View Details
DNAJB14 Protein Lysate (Rat) with C-HA Tag
18379036 100 µg

DNAJB14 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Human Major Histocompatibility Complex Class I B (MHCB) ELISA Kit
orb778618-01 48 Tests

Human Major Histocompatibility Complex Class I B (MHCB) ELISA Kit

Sign In for Pricing
View Details