Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-2 (TVB62)

This Recombinant Human T cell receptor beta variable 6-2 (TVB62) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-2 TRBV6-2

UniProt

A0A0J9YXY3

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPT / TAU pThr205 Rabbit Polyclonal Antibody
AP02400PU-S 50 µL

MAPT / TAU pThr205 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CF®647 Goat Anti-Mouse IgG3 (γ3), 2mg/mL
#20930-250uL 1x 250 µL

CF®647 Goat Anti-Mouse IgG3 (γ3), 2mg/mL

Sign In for Pricing
View Details
MYO7A Polyclonal Antibody
E-AB-13433-01 20 µL

MYO7A Polyclonal Antibody

Sign In for Pricing
View Details
MYO7A Polyclonal Antibody
E-AB-13433-02 60 µL

MYO7A Polyclonal Antibody

Sign In for Pricing
View Details
MYO7A Polyclonal Antibody
E-AB-13433-03 120 µL

MYO7A Polyclonal Antibody

Sign In for Pricing
View Details
MYO7A Polyclonal Antibody
E-AB-13433-04 200 µL

MYO7A Polyclonal Antibody

Sign In for Pricing
View Details