Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 30 (TVB30)

This Recombinant Human T cell receptor beta variable 30 (TVB30) spans the amino acid sequence from region 19-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 30 TRBV30

UniProt

A0A0K0K1B3

Expression Region

19-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tomoregulin-1 (TMEFF1) Antibody (Biotin Conjugate)
35774-05121 150 µg

Human Tomoregulin-1 (TMEFF1) Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
TMX2 (TXNDC14) discontinued
515144 100 µg

TMX2 (TXNDC14) discontinued

Sign In for Pricing
View Details
Recombinant Salmonella schwarzengrund DNA replication terminus site-binding protein (tus)
MBS1136396-01 0.02 mg (E-Coli)

Recombinant Salmonella schwarzengrund DNA replication terminus site-binding protein (tus)

Sign In for Pricing
View Details
Recombinant Salmonella schwarzengrund DNA replication terminus site-binding protein (tus)
MBS1136396-02 0.02 mg (Yeast)

Recombinant Salmonella schwarzengrund DNA replication terminus site-binding protein (tus)

Sign In for Pricing
View Details
Recombinant Salmonella schwarzengrund DNA replication terminus site-binding protein (tus)
MBS1136396-03 0.1 mg (E-Coli)

Recombinant Salmonella schwarzengrund DNA replication terminus site-binding protein (tus)

Sign In for Pricing
View Details
Recombinant Salmonella schwarzengrund DNA replication terminus site-binding protein (tus)
MBS1136396-04 0.1 mg (Yeast)

Recombinant Salmonella schwarzengrund DNA replication terminus site-binding protein (tus)

Sign In for Pricing
View Details