Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 27 (TVB27)

This Recombinant Human T cell receptor beta variable 27 (TVB27) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 27 TRBV27

UniProt

A0A0K0K1C4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSMNVEVTDKGDVPEGYKVSRKEKRNFPLILESPSPNQTSLYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TENT5C (NM_017709) Human Recombinant Protein
TP315475 20 µg

TENT5C (NM_017709) Human Recombinant Protein

Sign In for Pricing
View Details
Ɑ-Hydroxy-ω-Azido PEG
1320000-00-5.1G 1 g

Ɑ-Hydroxy-ω-Azido PEG

Sign In for Pricing
View Details
7-Ketoabiraterone Acetate
TRC-K170980-10MG 10 mg

7-Ketoabiraterone Acetate

Sign In for Pricing
View Details
Human CT47A10 activation kit by CRISPRa
GA118899 1 Kit

Human CT47A10 activation kit by CRISPRa

Sign In for Pricing
View Details
Bisphenol E-13C6
TRC-B519482-5MG 5 mg

Bisphenol E-13C6

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB527703 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details