Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-1 (TVB61)

This Recombinant Human T cell receptor beta variable 6-1 (TVB61) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-1 TRBV6-1

UniProt

A0A0K0K1D8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RELB Polyclonal Antibody
D-AB-10294L-01 25 µL

RELB Polyclonal Antibody

Sign In for Pricing
View Details
RELB Polyclonal Antibody
D-AB-10294L-02 100 µL

RELB Polyclonal Antibody

Sign In for Pricing
View Details
AccuGreenTM Broad Range dsDNA Quantitation Solution (500 assays)
#31070 1 Kit

AccuGreenTM Broad Range dsDNA Quantitation Solution (500 assays)

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR562811 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
4-Aminobutyric-2,2-d2 Acid
TRC-A602921-2.5MG 2.5 mg

4-Aminobutyric-2,2-d2 Acid

Sign In for Pricing
View Details
ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2683), CF647 conjugate, 0.1mg/mL
BNC472683-100 1x 100 µL

ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2683), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details