Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-1 (TVB61)

This Recombinant Human T cell receptor beta variable 6-1 (TVB61) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-1 TRBV6-1

UniProt

A0A0K0K1D8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mono[2-(perfluorooctyl)ethyl] Glucuronide
TRC-M566810-10MG 10 mg

Mono[2-(perfluorooctyl)ethyl] Glucuronide

Sign In for Pricing
View Details
PRKRA (NM_001139518) Human Over-expression Lysate
LY427978 100 µg

PRKRA (NM_001139518) Human Over-expression Lysate

Sign In for Pricing
View Details
Spata19 (BC049742) Mouse Tagged ORF Clone
MG200554 10 µg

Spata19 (BC049742) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD2 (LFA2/600), Biotin conjugate, 0.1mg/mL
BNCB0600-100 1x 100 µL

CD2 (LFA2/600), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (rLPSR/2408), CF405S conjugate, 0.1mg/mL
BNC043788-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (rLPSR/2408), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Analytical Balance BBAL-106
BBAL-106 1 Unit

Analytical Balance BBAL-106

Sign In for Pricing
View Details