Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-1 (TVB61)

This Recombinant Human T cell receptor beta variable 6-1 (TVB61) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-1 TRBV6-1

UniProt

A0A0K0K1D8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD56 / NCAM (123C3.D5 + 123A8), Biotin conjugate, 0.1mg/mL
BNCB0693-100 1x 100 µL

CD56 / NCAM (123C3.D5 + 123A8), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MPPED2 (NM_001584) Human Over-expression Lysate
LC419851 20 µg

MPPED2 (NM_001584) Human Over-expression Lysate

Sign In for Pricing
View Details
Glucokinase (GCK) Rabbit Polyclonal Antibody
TA363713 100 µL

Glucokinase (GCK) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Legumain/LGMN Protein (His Tag)
PKSM040307 50 µg

Recombinant Mouse Legumain/LGMN Protein (His Tag)

Sign In for Pricing
View Details
UNC5B (NM_170744) Human Recombinant Protein
TP318267L 1 mg

UNC5B (NM_170744) Human Recombinant Protein

Sign In for Pricing
View Details
CD71 (TFRC/1149), CF740 conjugate, 0.1mg/mL
BNC741149-100 1x 100 µL

CD71 (TFRC/1149), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details