Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-7 (TVB77)

This Recombinant Human T cell receptor beta variable 7-7 (TVB77) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-7 TRBV7-7

UniProt

A0A0K0K1E9

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVTLRCDPISSHATLYWYQQALGQGPEFLTYFNYEAQPDKSGLPSDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD79B Antibody[CB3-1]
AN004810P-01 25 µg

Purified Anti-Human CD79B Antibody[CB3-1]

Sign In for Pricing
View Details
Purified Anti-Human CD79B Antibody[CB3-1]
AN004810P-02 100 µg

Purified Anti-Human CD79B Antibody[CB3-1]

Sign In for Pricing
View Details
Calnexin (CANX) Rabbit Polyclonal Antibody
AP22895PU-N 50 µg

Calnexin (CANX) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLEC9A (1F6), CF568 conjugate, 0.1mg/mL
BNC682209-500 1x 500 µL

CLEC9A (1F6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Basic Water Purification System BBPS-301
BBPS-301 1 Unit

Basic Water Purification System BBPS-301

Sign In for Pricing
View Details
NEK2 Rabbit Monoclonal Antibody [Clone ID: 23GB2085]
TA425001 100 µL

NEK2 Rabbit Monoclonal Antibody [Clone ID: 23GB2085]

Sign In for Pricing
View Details