Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-3 (TVBJ3)

This Recombinant Human T cell receptor beta variable 10-3 (TVBJ3) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-3 TRBV10-3

UniProt

A0A0K0K1G6

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-500 1x 500 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Accuris™ Compact Balance, 500 grams, readability 0.01grams, 115V
W3300-500 1 Each

Accuris™ Compact Balance, 500 grams, readability 0.01grams, 115V

Sign In for Pricing
View Details
PCDHA8 Human Gene Knockout Kit (CRISPR)
KN418888 1 Kit

PCDHA8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MultiTherm Touch Vortex Mixer, 100-240V with US cord
H5100-HCT 1 Each

MultiTherm Touch Vortex Mixer, 100-240V with US cord

Sign In for Pricing
View Details
C-Jun (Ab-93) Antibody
8B7133-AAT 50 µg

C-Jun (Ab-93) Antibody

Sign In for Pricing
View Details
Synaptotagmin 1 (SYT1) pSer309 Rabbit Polyclonal Antibody
AP09491PU-S 50 µL

Synaptotagmin 1 (SYT1) pSer309 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details